PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3NG044400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 959aa    MW: 105932 Da    PI: 5.2528
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3NG044400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.73.6e-204894148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT+eEd++l +av+ + g++Wk+Ia++++ gRt+ qc +rwqk+l
  Pavir.3NG044400.1.p 48 KGNWTAEEDDILRKAVETYKGKNWKKIAECFP-GRTDVQCLHRWQKVL 94
                         79******************************.************986 PP

2Myb_DNA-binding61.12.4e-19100146148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          +g+W++eEde++++ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  Pavir.3NG044400.1.p 100 KGPWSKEEDEIIIQMVNKLGPKKWSTIAQALP-GRIGKQCRERWHNHL 146
                          79******************************.*************97 PP

3Myb_DNA-binding48.22.6e-15152194145
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                          +++WT+eE+ +l++a++ +G++ W+   + ++ gRt++ +k++w+
  Pavir.3NG044400.1.p 152 KDAWTQEEEIKLIHAHQTYGNK-WAELTKFLP-GRTDNAIKNHWH 194
                          679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.1794394IPR017930Myb domain
SuperFamilySSF466892.73E-164598IPR009057Homeodomain-like
SMARTSM007171.1E-184796IPR001005SANT/Myb domain
PfamPF002491.4E-174894IPR001005SANT/Myb domain
CDDcd001675.88E-165094No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2550111IPR009057Homeodomain-like
PROSITE profilePS5129432.0495150IPR017930Myb domain
SuperFamilySSF466894.67E-3197193IPR009057Homeodomain-like
SMARTSM007175.3E-1899148IPR001005SANT/Myb domain
PfamPF002491.3E-17100146IPR001005SANT/Myb domain
CDDcd001671.07E-15102146No hitNo description
Gene3DG3DSA:1.10.10.609.4E-26112152IPR009057Homeodomain-like
PROSITE profilePS5129419.607151201IPR017930Myb domain
SMARTSM007172.8E-14151199IPR001005SANT/Myb domain
PfamPF002491.9E-13152194IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-21153201IPR009057Homeodomain-like
CDDcd001674.35E-11154194No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 959 aa     Download sequence    Send to blast
MTSEGLMTSK GTEASAPDVP PDEGVRREPR KGRLPNGRIT GPARRSSKGN WTAEEDDILR  60
KAVETYKGKN WKKIAECFPG RTDVQCLHRW QKVLNPELVK GPWSKEEDEI IIQMVNKLGP  120
KKWSTIAQAL PGRIGKQCRE RWHNHLNPGI NKDAWTQEEE IKLIHAHQTY GNKWAELTKF  180
LPGRTDNAIK NHWHSSVKKK IDSYRASGLL AQLQGLAPIE YTTCGLSVDS SSATTNQISE  240
DSGLNVFREV EDSTDLSQSS FAKGSCSQEE QTDVALGSHL NVHESLCQDG TNADNAASAL  300
PEMHHQLSTS DMDQDKHFQD DLSQGMDLDK HLQLQQEFSQ GMDLHVDIDE VPNNFVITDS  360
QASNELTGQF QDTQIMHSSE NDGVSLIPYA VTPCVSILPS VPGCENNINM MCEVGVKNGD  420
CFQSEQWQNT SIQPISHPSE AASNFSAPLY PSLQTSEPAT MMGDPLYYQS SVTSLPPSFI  480
SSDGASNASD VKFETSRYPV SHQDLEIKTC HNSSGDPDQS SYISREGDRN RTSEPIDSIP  540
DSEKKQLVDL EQSCLEPTTY IGKEALSSHG DSVLREKENA GALCYEPPCF ASFEVPFVSC  600
ELVTSSDLPE YSPLGIRELM RSSLNFPTPV RLWGSPTRDG SPDAVLKNAA KSFVCTPSIM  660
KKRPRDLSSP SPDIRNEKRL NTEKDCGRSV MSSTRIGKSF MDTPDDFVDL VSPTRKTAFQ  720
KKLKLSQENI ENLNQITDQG EHEGNAKHSA GILTDSSVNN LNTPKHGPNY ESQRLNTSAK  780
AWSNSKDIIF SRSKPSELLV EKSIPCIDAD YEYVNILADT PGIKRGLESP SAWKSPFFTP  840
FQDAYFMSPA SRAFDALGLV KQINEQSAAA LEEAHEVLAS GSPWKRHCKE NNDKENTAWK  900
NEVGTSKPPS KPMAEGRVLD FNECSTPVRM KEDKKVDLAL GGSASSPVGS SYLRMNVR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C6e-66482016159MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-66482016159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.184061e-106leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960645.10.0PREDICTED: myb-related protein 3R-1
RefseqXP_004960646.10.0PREDICTED: myb-related protein 3R-1
RefseqXP_004960647.10.0PREDICTED: myb-related protein 3R-1
TrEMBLK3Z3V00.0K3Z3V0_SETIT; Uncharacterized protein
STRINGSi021218m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.22e-97myb domain protein 3r-4